PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009102939.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CO-like
Protein Properties Length: 308aa    MW: 34026.1 Da    PI: 5.9959
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009102939.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box17.21e-05546237
        zf-B_box  2 eerkCpeHeekelqlfCedCqqllCedClleeHkg......H 37
                    e + C+ ++e  + lfC+ +   lC  C ++ H        H
  XP_009102939.1  5 ERHPCEFCGERAAVLFCRADTAKLCLPCDQHVHTAnllskkH 46
                    6789******99******************999444555555 PP

2zf-B_box23.11.5e-074980334
        zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeH 34
                     ++C+++++++++  C++++  lC+dC    H
  XP_009102939.1 49 SQICDNCGNEPVSVRCFTDNLVLCQDCDWDVH 80
                    689************************98777 PP

3CCT69.87e-24260303144
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                     R++a++RYkeKrktR+++K+irYesRKa+A++R RvKGrFvk++
  XP_009102939.1 260 RDNAMQRYKEKRKTRRYDKTIRYESRKATADTRLRVKGRFVKAT 303
                     899***************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003364.8E-11451IPR000315B-box-type zinc finger
PROSITE profilePS501199.2451IPR000315B-box-type zinc finger
CDDcd000212.30E-7851No hitNo description
PROSITE profilePS501198.7174794IPR000315B-box-type zinc finger
PfamPF006432.8E-54980IPR000315B-box-type zinc finger
CDDcd000218.23E-85180No hitNo description
SMARTSM003360.455294IPR000315B-box-type zinc finger
PfamPF062033.9E-18260302IPR010402CCT domain
PROSITE profilePS5101715.12260302IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MSSSERHPCE FCGERAAVLF CRADTAKLCL PCDQHVHTAN LLSKKHVRSQ ICDNCGNEPV  60
SVRCFTDNLV LCQDCDWDVH GSCSVSDAHV RSALEGFSGC PSALELAALL GVDLGGRKEE  120
NEGPTMESFG MQLDSWVTGS NVLQELVVPV PKETTSFRKR GSSCCGRYKQ VLCKQLEELF  180
NNGDNDGDGE GEGGGEAREG LMVPEMPERM GRARDAEEIN SGGEVIQQPP TTSFTSLLLN  240
ADNPSASSAG RTTQIWDFNR DNAMQRYKEK RKTRRYDKTI RYESRKATAD TRLRVKGRFV  300
KATEAPYP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.65490.0flower| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1891941e-114AC189194.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB003O07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013653237.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 15-like
RefseqXP_009102939.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 15-like
SwissprotQ9C7E81e-109COL15_ARATH; Zinc finger protein CONSTANS-LIKE 15
TrEMBLM4EMQ00.0M4EMQ0_BRARP; Uncharacterized protein
STRINGBra030070.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38712647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28050.11e-109B-box type zinc finger protein with CCT domain